melamine

	Melamine Ashtray
	melamine ashtray features:Safe and durable use ashtray made of 100% melamineDeep Bluecolour melamine ashtray with silk printing for logoDifferent colours From Xiamen Jover Imp. & Exp. Co., Ltd. [China]
[Related Keywords: Ashtray, Melamine 7933, Jover]

	Melamine Ashtray
	Features:1).Melamine ashtray 2). Dimensions:90*30mm3). Package: inner and outer package can be decided by customers' detailed requirementsInner packing: From Hangzhou Hushen Appliance Co., Ltd. [Thailand]
[Related Keywords: melamine ashtray]

	ASHTRAY
	411#(90*72*32);414#(77*72*32);415#(81*50);410#(100*43) From DUNWELL TECH INC [China]
[Related Keywords: MELAMINE ASHTRAY]

	melamine ashtray
	1 Tasteless and Non-toxic 2 Shatter proof3 Heat resistant, Safe temperature scope can reach up to-30oC +120oC4 Various designs available5 Material:100% From Wenzhou Import and Export United Co., Ltd. [China]
[Related Keywords: melamine tableware, melamine ashtray, HS]

	Desk(Melamine)
	Feature:1)Main material:Melamine Faced Board2)The MDF or particle board as the substrate, Cover surface with decorative melamine impregnated sheet. Surface From Xixia County Yuanhang Furniture Co., Ltd. [Pakistan]
[Related Keywords: computer desk, Desk(Melamine), YuanHang]

	Portable Ashtray(ashtray, pocket ashtray, melamine ashtray)
	Portable Ashtray(ashtray, pocket ashtray, melamine ashtray)Features: 1) Various colors for your choice 2) Dimensions: 7.9*3.1*1.7cm From Wenzhou Anda Smoking Sets Co., Ltd. [China]
[Related Keywords: ashtray, Portable Ashtray( pocket melamine ashtray)]

	melamine ashtray
	1 Tasteless and Non-toxic 2 Shatter proof3 Heat resistant, Safe temperature scope can reach up to-30oC +120oC4 Various designs available5 Material:100% From Wenzhou Import and Export United Co., Ltd. [China]
[Related Keywords: melamine ware, melamine ashtray, HS]

	melamine ashtray
	wecanprovidemanykindsashtray.itisfashionableandcolorful,lightweigt. Havemanyspecifications,andatthesametimecanbedoOEMaccording o urcustomersdemandsandrequirement From Wenzhou Huier Trade Co., Ltd. [France]
[Related Keywords: ashtray, Huier]

	Melamine Ashtray
	Features:1).Melamine ashtray 2). Dimensions:176*33mm3). Package: inner and outer package can be decided by customers' detailed requirementsInner packing: From Hangzhou Hushen Appliance Co., Ltd. [Thailand]
[Related Keywords: melamine ashtray]

	melamine ashtray
	1.material:melamine2.size:11.7*11.7*3cm3.weight:125gwelcome customers' inquiry. From Wenzhou Hopeful Plastic Industry Co., Ltd. [China]
[Related Keywords: ashtray]

1234567891011121314151617181920Next show 1 ~ 10 of 199  Total 20 pages

Email this page Bookmark this page